PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_3061_f_7
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family MYB
Protein Properties Length: 411aa    MW: 46118.6 Da    PI: 6.7
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_3061_f_7genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.61.8e-15102147147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg W + Ed +l+++v ++G+ +W++Ia+++  gR++k+c++rw++ 
    Neem_3061_f_7 102 RGHWRPAEDTKLKELVGLYGPQNWNLIAEKLE-GRSGKSCRLRWFNQ 147
                      899*****************************.***********996 PP

2Myb_DNA-binding57.43.4e-18154197146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      r ++T+eE+e+l +a++++G++ W+ Iar ++ gRt++ +k++w+ 
    Neem_3061_f_7 154 RRAFTEEEEERLMQAHRLYGNK-WAMIARLFP-GRTDNAVKNHWHV 197
                      678*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.88897148IPR017930Myb domain
SMARTSM007172.1E-13101150IPR001005SANT/Myb domain
SuperFamilySSF466896.74E-28102195IPR009057Homeodomain-like
PfamPF002495.4E-15102147IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.1E-25103155IPR009057Homeodomain-like
CDDcd001672.13E-12105146No hitNo description
PROSITE profilePS5129427.592149203IPR017930Myb domain
SMARTSM007178.2E-15153201IPR001005SANT/Myb domain
PfamPF002495.4E-15154196IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.0E-21156202IPR009057Homeodomain-like
CDDcd001674.36E-12156196No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010199Biological Processorgan boundary specification between lateral organs and the meristem
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 411 aa     Download sequence    Send to blast
MGVQFLLLLK IFIPCKSSEM ENEGACWSFP FMENGSSTTG NFEEQHNIDV NVVSKGSDCS  60
DGFGENSESM IHDIDLNEEF NPNENSVTGK ETDGGQTKIC ARGHWRPAED TKLKELVGLY  120
GPQNWNLIAE KLEGRSGKSC RLRWFNQLDP RINRRAFTEE EEERLMQAHR LYGNKWAMIA  180
RLFPGRTDNA VKNHWHVIMA RKYREQSSAY RRRKLNQSIY RRIEDMPNFV GKDAAAGRFE  240
QQLLQQPYCL NIPNGGLGNL SPFPYGNFNG GGVGFDYCLN GSPYMVIGQE AISINKVPHS  300
GFFAQHMTSD LFSAGPKSND MMGMFSHNIR SWDTPLDEPH ISAFNPKYLM AMQQSNVHNH  360
PDSFLHSTAS NPQVSGSEAS SSSVPAGNRS VASRFDTIPP PFIDFLGVGA R
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-341022027107B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00222DAPTransfer from AT1G69560Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015387159.11e-172PREDICTED: transcription factor MYB108-like
TrEMBLA0A067GW841e-176A0A067GW84_CITSI; Uncharacterized protein
STRINGPOPTR_0008s08760.11e-167(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM12102896
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69560.17e-78myb domain protein 105